We noticed that you're using an unsupported browser. The TripAdvisor website may not display properly.We support the following browsers:
Windows: Internet Explorer, Mozilla Firefox, Google Chrome. Mac: Safari.
Save
Share
Review Highlights
Beautiful setting and a moscato I am proud to drink!

As a family with two primary school aged children and one two year old spoodle we decided to visit... read more

Reviewed 11 June 2018
Lyzzee1977
,
Sydney, Australia
via mobile
Amazing wine and welcome

We visited Domaine de Binet winery while we were staying at Lovedale. It was well worth it. The... read more

Reviewed 3 April 2018
lsweets501
,
Sydney, Australia
via mobile
Read all 20 reviews
6
All photos (6)
Full view
Traveller Overview
  • Excellent85%
  • Very good15%
  • Average0%
  • Poor0%
  • Terrible0%
Travellers talk about
“pinot grigio”(4 reviews)
“wine maker”(3 reviews)
“amazing wine”(2 reviews)
About
Over 30 years in the making, Domaine de Binet is the realization of a young boy’s dream and is the family label of winemaker Daniel Binet. Domaine de Binet Wine Company focuses on interesting wine regions and alternate varietals. Visit the working...more
Contact
469 Lovedale Rd, Lovedale, Cessnock, New South Wales 2325, Australia
Website
+61 418 211 378
Call
Reviews (20)
Filter reviews
20 results
Traveller rating
17
3
0
0
0
Traveller type
Time of year
LanguageEnglish
17
3
0
0
0
Show reviews that mention
All reviewspinot grigiowine makeramazing winehunter valleydanielwinemakingvarietalsvarietiesgrapeswinemakerdoorswinerycellarbottletastewinestasting
FilterEnglish
Updating list...
1 - 10 of 20 reviews
Reviewed 9 August 2018

Drop in for something that's different, yet good. You can find your basic Shiraz or even Moscato here, and they'll still be very good. We picked up a Moscato, purely because of how good it was. But the best thing about this experience was the...More

Thank TravellingCarlito
Reviewed 11 June 2018 via mobile

As a family with two primary school aged children and one two year old spoodle we decided to visit Domaine de Binet as it is dog friendly. We have never been more grateful to the dog. We were greeted by a lovely lady who gave...More

Thank Lyzzee1977
Reviewed 3 April 2018 via mobile

We visited Domaine de Binet winery while we were staying at Lovedale. It was well worth it. The wine maker Daniel was extremely welcoming and entertaining plus his wine is delicious. We dropped back in the next day to sit on the beautiful deck and...More

Thank lsweets501
Reviewed 20 November 2017

A wonderful experience was had by all at Domaine de Binet. Nat was extremely friendly and knowledgeable, and she gave he us her undivided attention whilst visiting. We tasted a variety of wines made form both local and regional grapes, with the Moscato, Le Grand...More

1  Thank sunseeker2013
Reviewed 16 August 2017

We walked across to Binet after a great lunch at Tatlers as it was recommended by Tatler staff. This place is a gem. Dan the winemaker was so accommodating, he was in the winery working and showed us around. He is making some cracker wines...More

1  Thank Darren P
Reviewed 13 August 2017 via mobile

Dropped into Domaine de Binet after having lunch next door at Tatler Tapas Cafe. What an unexpected treat! Dan was filtering a batch of wine but made time to show us his excellent winery and share some of his knowledge. After enjoying several wines in...More

1  Thank Lindon S
Reviewed 4 July 2017 via mobile

We had a really fun time at Domain de Binet. Lovely, new setting that was way more enjoyable than some of the mega cellar doors. Beautiful location- taste a few, grab a bottle and sit on the lawn taking in the view. Definitely worth calling...More

1  Thank Amacdog
Reviewed 3 July 2017

We really enjoyed it here and they have some great wines. For something out of the ordinary try "The Accidental Tourist"

1  Thank David B
Reviewed 15 April 2017 via mobile

Dan the wine maker was a fabulous host at this winery gem in the heart of the Hunter Valley. Great spot to relax and try Dan's experimental varietals. Well worth the trip! Recommend Pinot Grigio, Semillion and Shiraz Cabernet. And bonus Australian Cattle dogs to...More

1  Thank Melbou27
Reviewed 13 February 2017 via mobile

Amazing wines and down to earth wine maker. One of the best experiences you will have in the hunter valley

1  Thank MattyKerr
View more reviews
Nearby
Nearby HotelsSee all 2 nearby hotels
Blackwattle Luxury Retreats
79 reviews
2.30 km away
Tonic Hotel
158 reviews
2.30 km away
Crowne Plaza Hunter Valley
1,832 reviews
3.94 km away
Chateau Elan At The Vintage Hunter Valley
1,344 reviews
4.15 km away
Nearby RestaurantsSee all 15 restaurants in Lovedale
Leaves & Fishes
299 reviews
1.98 km away
Lillino
310 reviews
3.07 km away
Emerson’s Cafe & Restaurant
457 reviews
.50 km away
The Legends Grill
383 reviews
4.26 km away
Nearby AttractionsSee all 21 attractions in Lovedale
Gartelmann Wines
75 reviews
1.04 km away
Tatler Wines
80 reviews
.26 km away
Hunter Trikes
58 reviews
1.36 km away
Questions & Answers
Get quick answers from Domaine de Binet staff and past visitors.
Note: your question will be posted publicly on the Questions & Answers page.
Submit
Posting guidelines